4.59 Rating by CuteStat

mommaidcrafts.com is 4 years 10 months old. It is a domain having com extension. It has a global traffic rank of #6576746 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, mommaidcrafts.com is SAFE to browse.

PageSpeed Score
84
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 128
Daily Pageviews: 256

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 388
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 3,890
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 6,576,746
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

23.227.38.65

Hosted Country:

Canada CA

Location Latitude:

45.4153

Location Longitude:

-75.6894
Mom-Maid Crafts & Co. – Opening Soon

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: UA-155194714-1

Websites Hosted on Same IP (i.e. 23.227.38.65)

Designer Fashion up to 70% Off Shoes, Handbags, Dresses & More – Bluef

- bluefly.com

With 3000+ brands, Bluefly is the online shopping destination for the style obsessed, shop designer styles from Prada, Gucci, Dior, Valentino up to 70% off

33,491 $ 434,160.00

Pier 1: Home Decor, Indoor & Patio Furniture

- pier1.com

Shop Pier 1 to outfit your home with inspiring home decor, rugs, furniture, dining room sets, Papasan chairs & more.

27,304 $ 532,800.00

HHGregg – HHgregg Electronics

- hhgregg.com

Shop hhgregg for Electronics, Cameras, Pro Video, Laptops, Headphones, Drones & more. Free shipping, installation on many of our products. Hurry in for best selection. Huge savings storewide!

470,203 $ 8,640.00

Women's Shoes, Men's Shoes, Socks, Foot Care & Comfort Products - Foot

- footsmart.com

Keep walking in comfort with footwear and accessories from FootSmart.com that help you get the perfect fit.

295,054 $ 30,240.00

SwimOutlet.com - The Web's Most Popular Swim Shop! 🏊

- swimoutlet.com

Shop online for swimwear, men's swimwear, women's swimwear, kids swimwear, swim gear, swim goggles, swim caps, lifeguard gear, water aerobics gear & just about everything else for the water.

19,756 $ 904,320.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Tue, 31 Dec 2019 03:07:04 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Sorting-Hat-PodId: 99
X-Sorting-Hat-ShopId: 15180693604
X-Frame-Options: DENY
X-ShopId: 15180693604
X-ShardId: 99
Content-Language: en
X-Shopify-Generated-Cart-Token: ac0fe72747b99a7a6eaca969f58fd788
Vary: Accept
X-Robots-Tag: nofollow
Strict-Transport-Security: max-age=7889238
ETag: cacheable:34780f973050f9cbafc90f8e8ea75592
X-Alternate-Cache-Key: cacheable:83b8996ab9e6e370479cfdf0c97c2c4a
Content-Encoding: gzip
X-Cache: miss
X-Shopify-Stage: production
Content-Security-Policy: block-all-mixed-content; frame-ancestors 'none'; upgrade-insecure-requests; report-uri /csp-report?source%5Baction%5D=password&source%5Bapp%5D=Shopify&source%5Bcontroller%5D=storefront_section%2Fstorefront&source%5Bsection%5D=storefront&source%5Buuid%5D=121b760d-151b-415c-9c9c-e6e868a4b016
X-Content-Type-Options: nosniff
X-Download-Options: noopen
X-Permitted-Cross-Domain-Policies: none
X-XSS-Protection: 1; mode=block; report=/xss-report?source%5Baction%5D=password&source%5Bapp%5D=Shopify&source%5Bcontroller%5D=storefront_section%2Fstorefront&source%5Bsection%5D=storefront&source%5Buuid%5D=121b760d-151b-415c-9c9c-e6e868a4b016
X-Dc: gcp-us-central1,gcp-us-east1,gcp-us-east1
NEL: {"report_to":"network-errors","max_age":2592000,"failure_fraction":0.01,"success_fraction":0.0001}
NEL: {"report_to":"network-errors","max_age":2592000,"failure_fraction":0.01,"success_fraction":0.0001}
Report-To: {"group":"network-errors","max_age":2592000,"endpoints":[{"url":"https://monorail-edge.shopifycloud.com/v1/reports/nel/20190325/shopify"}]}
Report-To: {"group":"network-errors","max_age":2592000,"endpoints":[{"url":"https://monorail-edge.shopifycloud.com/v1/reports/nel/20190325/shopify"}]}
X-Request-ID: 121b760d-151b-415c-9c9c-e6e868a4b016
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 54d90a880f8a9654-SJC

Domain Information

Domain Registrar: TUCOWS, INC.
Registration Date: May 31, 2019, 8:50 PM 4 years 10 months 3 weeks ago
Expiration Date: May 31, 2020, 8:50 PM 3 years 10 months 3 weeks ago
Domain Status:
clienttransferprohibited
clientupdateprohibited

Domain Nameserver Information

Host IP Address Country
ns-cloud-e1.googledomains.com 216.239.32.110 United States of America United States of America
ns-cloud-e2.googledomains.com 216.239.34.110 United States of America United States of America
ns-cloud-e3.googledomains.com 216.239.36.110 United States of America United States of America
ns-cloud-e4.googledomains.com 216.239.38.110 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
mommaidcrafts.com A 10799 IP: 23.227.38.65
mommaidcrafts.com NS 21600 Target: ns-cloud-e3.googledomains.com
mommaidcrafts.com NS 21600 Target: ns-cloud-e4.googledomains.com
mommaidcrafts.com NS 21600 Target: ns-cloud-e1.googledomains.com
mommaidcrafts.com NS 21600 Target: ns-cloud-e2.googledomains.com
mommaidcrafts.com SOA 300 MNAME: ns-cloud-e1.googledomains.com
RNAME: cloud-dns-hostmaster.google.com
Serial: 1
Refresh: 21600
Retry: 3600
Expire: 259200
Minimum TTL: 300
mommaidcrafts.com MX 86400 Priority: 1
Target: mx.mommaidcrafts.com.cust.b.hostedemail.com

Similarly Ranked Websites

Neosho School District / Homepage

- neoshosd.org
6,576,752 $ 240.00

Swept Away Media: Swept Away TV and The Rock Star Stories

- sweptawaytv.com

Youth not for profit media marketing, social media marketing, video production and promotion located in Boynton Beach FL. working with students worldwide.

6,576,767 $ 240.00

BNN1-1(2)

- pegahchat.com
6,576,771 $ 240.00

Risperdal Tardive Dyskinesia Lawsuit | Risperdal Lawsuits

- risperdaltardivedyskinesialawsuit.com

Lawsuit information for individuals who have experienced tardive dyskinesia as a result of using Risperdal. Learn more and find out how to get help.

6,576,774 $ 8.95

newDemocracy Foundation

- newdemocracy.com.au

newDemocracy is a not-for-profit research group, with a particular focus on best-practice citizen engagement and innovations in democratic structures.

6,576,776 $ 240.00

Full WHOIS Lookup

Domain Name: MOMMAIDCRAFTS.COM
Registry Domain ID: 2397368139_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://tucowsdomains.com
Updated Date: 2019-05-31T20:53:07
Creation Date: 2019-05-31T20:50:44
Registrar Registration Expiration Date: 2020-05-31T20:50:44
Registrar: TUCOWS, INC.
Registrar IANA ID: 69
Reseller: Shopify
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID:
Registrant Name: Contact Privacy Inc. Customer 0154871588
Registrant Organization: Contact Privacy Inc. Customer 0154871588
Registrant Street: 96 Mowat Ave
Registrant City: Toronto
Registrant State/Province: ON
Registrant Postal Code: M6K 3M1
Registrant Country: CA
Registrant Phone: +1.4165385457
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: mommaidcrafts.com@contactprivacy.com
Registry Admin ID:
Admin Name: Contact Privacy Inc. Customer 0154871588
Admin Organization: Contact Privacy Inc. Customer 0154871588
Admin Street: 96 Mowat Ave
Admin City: Toronto
Admin State/Province: ON
Admin Postal Code: M6K 3M1
Admin Country: CA
Admin Phone: +1.4165385457
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: mommaidcrafts.com@contactprivacy.com
Registry Tech ID:
Tech Name: Contact Privacy Inc. Customer 0154871588
Tech Organization: Contact Privacy Inc. Customer 0154871588
Tech Street: 96 Mowat Ave
Tech City: Toronto
Tech State/Province: ON
Tech Postal Code: M6K 3M1
Tech Country: CA
Tech Phone: +1.4165385457
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: mommaidcrafts.com@contactprivacy.com
Name Server: ns-cloud-e1.googledomains.com
Name Server: ns-cloud-e2.googledomains.com
Name Server: ns-cloud-e3.googledomains.com
Name Server: ns-cloud-e4.googledomains.com
DNSSEC: unsigned
Registrar Abuse Contact Email: domainabuse@tucows.com
Registrar Abuse Contact Phone: +1.4165350123
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-05-31T20:53:07 <<<

"For more information on Whois status codes, please visit https://icann.org/epp"

Registration Service Provider:
Shopify, domainsupport@shopify.com
+1.8667040252
http://www.shopify.com


The Data in the Tucows Registrar WHOIS database is provided to you by Tucows
for information purposes only, and may be used to assist you in obtaining
information about or related to a domain name's registration record.

Tucows makes this information available "as is," and does not guarantee its
accuracy.

By submitting a WHOIS query, you agree that you will use this data only for
lawful purposes and that, under no circumstances will you use this data to:
a) allow, enable, or otherwise support the transmission by e-mail,
telephone, or facsimile of mass, unsolicited, commercial advertising or
solicitations to entities other than the data recipient's own existing
customers; or (b) enable high volume, automated, electronic processes that
send queries or data to the systems of any Registry Operator or
ICANN-Accredited registrar, except as reasonably necessary to register
domain names or modify existing registrations.

The compilation, repackaging, dissemination or other use of this Data is
expressly prohibited without the prior written consent of Tucows.

Tucows reserves the right to terminate your access to the Tucows WHOIS
database in its sole discretion, including without limitation, for excessive
querying of the WHOIS database or for failure to otherwise abide by this
policy.

Tucows reserves the right to modify these terms at any time.

By submitting this query, you agree to abide by these terms.

NOTE: THE WHOIS DATABASE IS A CONTACT DATABASE ONLY. LACK OF A DOMAIN
RECORD DOES NOT SIGNIFY DOMAIN AVAILABILITY.